binsearch.info

basic search - advanced search - F.A.Q. - watchlist - disclaimer - browse newsgroups - RSS  
   
 

Newsgroup alt.binaries.multimedia

Results

Apply filter: only show collections - only show posts with NFO

SubjectPosterDate
[Art-of-Use.net] - [14/37] - "201612-HEQdmAcFTT2Juv-AoU.part13.rar" yEnc (1/55)
collection size: 14.38 MB, parts available: 40 / 743
- 4 par2 files
- 11 rar files
yEncBin03-Dec
[Art-of-Use.net] - [02/27] - "201612-HDKh3JTdk4XuIC-AoU.part01.rar" yEnc (1/55)
collection size: 7.61 MB, parts available: 20 / 385
- 7 rar files
yEncBin03-Dec
[161203_002] The Expanse 1x02 [1/1] "The.Expanse.S01E02.FRENCH.720p.WEBRip.DD5.1.H264.B18KSU-LiBERTY.nfo" - 3,99 kB - yEnc (1/1)
view NFO
RealWorld 03-Dec
Nemicamatissima Heather Parisi Lorella Cuccarini 02-12-16 (2h 20min 3secs) - [075/105] "Nemicamatissima Heather Parisi Lorella Cuccarini 02-12-16 (2h 20min 3secs) (H264 1080i AC3 dvbt).ts.jpg" yEnc (1/2)CPP-User03-Dec
Hnuunnrriqo-42332277859-201612032153 [1/215] - "Hnuunnrriqo-42332277859-201612032153.par2" yEnc (1/1) 108200
collection size: 3.64 MB, parts available: 6 / 420
- 1 rar file
- 1 par2 file
radombk03-Dec
American.Horror.Story.6x07.La.Carneficina.ITA.DLMux.x264-NovaRip [03/20] - "american.horror.story.6x07.ita.dlmux.x264-novarip.part01.rar" yEnc (1/69)
collection size: 48.52 MB, parts available: 68 / 574
- 6 par2 files
- 8 rar files
ita.tv 03-Dec
American.Horror.Story.6x07.La.Carneficina.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip [01/45] - "american.horror.story.6x07.ita-eng.1080p.dlmux.dd5.1.h264-novarip.nfo" yEnc (1/1)
collection size: 327.25 MB, parts available: 447 / 2290
- 9 par2 files
- 30 rar files
- 1 nfo file
view NFO
ita.tv 03-Dec
rdskyadfhldshflahfhkdwekhlqw - [02/29] - "rdskyadfhldshflahfhkdwekhlqw.part01.rar" yEnc (1/1303)
collection size: 8.34 GB, parts available: 22483 / 25499
- 10 par2 files
- 19 rar files
yEncBin03-Dec
rbcfkhgklshglshlshgldghls - [01/29] - "rbcfkhgklshglshlshgldghls.par2" yEnc (1/1)
collection size: 9.18 GB, parts available: 24761 / 25233
- 10 par2 files
- 19 rar files
yEncBin03-Dec
gggsdjkafgaklsdfhalhsfal - [02/30] - "gggsdjkafgaklsdfhalhsfal.part01.rar" yEnc (1/1303)
collection size: 9.78 GB, parts available: 26392 / 26396
- 10 par2 files
- 20 rar files
yEncBin03-Dec
emrldfrsdrtsgdfsuygkgahl - [01/28] - "emrldfrsdrtsgdfsuygkgahl.par2" yEnc (1/1)
collection size: 8.5 GB, parts available: 22927 / 22927
- 11 par2 files
- 17 rar files
yEncBin03-Dec
The.Blacklist.4x05.L.Impresa.Lindquist.ITA.DLMux.x264-NovaRip [1/1] - "The.Blacklist.4x05.L.Impresa.Lindquist.ITA.DLMux.x264-NovaRip.nzb" yEnc (1/1)ita.tv 03-Dec
The.Blacklist.4x05.L.Impresa.Lindquist.ITA.DLMux.x264-NovaRip [02/18] - "the.blacklist.4x05.ita.dlmux.x264-novarip.par2" yEnc (1/1)
collection size: 411.12 MB, parts available: 557 / 557
- 9 par2 files
- 8 rar files
- 1 nfo file
view NFO
ita.tv 03-Dec
The.Blacklist.4x05.L.Impresa.Lindquist.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip [1/1] - "The.Blacklist.4x05.L.Impresa.Lindquist.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip.nzb" yEnc (1/1)ita.tv 03-Dec
The.Blacklist.4x05.L.Impresa.Lindquist.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip [01/49] - "the.blacklist.4x05.ita-eng.1080p.dlmux.dd5.1.h264-novarip.nfo" yEnc (1/1)
collection size: 2.11 GB, parts available: 2888 / 2888
- 10 par2 files
- 38 rar files
- 1 nfo file
view NFO
ita.tv 03-Dec
Ndahrairai-2164768768-201612021942 [10/68] - "Ndahrairai-2164768768-201612021942.part09.rar" yEnc (1/70) 50000000
collection size: 1.79 GB, parts available: 2599 / 4187
- 44 rar files
- 16 par2 files
radombk02-Dec
Quantico.2x04.Kubark.ITA.DLMux.x264-NovaRip [1/1] - "Quantico.2x04.Kubark.ITA.DLMux.x264-NovaRip.nzb" yEnc (1/1)ita.tv 03-Dec
Quantico.2x04.Kubark.ITA.DLMux.x264-NovaRip [01/18] - "quantico.2x04.ita.dlmux.x264-novarip.nfo" yEnc (1/1)
collection size: 411.07 MB, parts available: 557 / 557
- 8 rar files
- 9 par2 files
- 1 nfo file
view NFO
ita.tv 03-Dec
Quantico.2x04.Kubark.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip [1/1] - "Quantico.2x04.Kubark.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip.nzb" yEnc (1/1)ita.tv 03-Dec
Quantico.2x04.Kubark.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip [02/49] - "quantico.2x04.ita-eng.1080p.dlmux.dd5.1.h264-novarip.par2" yEnc (1/1)
collection size: 2.1 GB, parts available: 2873 / 2873
- 10 par2 files
- 38 rar files
- 1 nfo file
view NFO
ita.tv 03-Dec
Qouhhhhhr-593444447-201612021936 [1/62] - "Qouhhhhhr-593444447-201612021936.par2" yEnc (1/1) 29552
collection size: 569.38 MB, parts available: 815 / 1269
- 40 rar files
- 21 par2 files
- 1 nzb file
- 1 sfv file
radombk02-Dec
Nemicamatissima Heather Parisi Lorella Cuccarini 02-12-16 (2h 20min 3secs) - [000/105] "Nemicamatissima Heather Parisi Lorella Cuccarini 02-12-16 (2h 20min 3secs).nzb" yEnc (1/9)
collection size: 7.26 GB, parts available: 19684 / 22088
- 13 par2 files
- 73 rar files
- 1 nzb file
CPP-User03-Dec
Angela Melillo-Pomeriggio Cinque 30-11-16 (29min 59secs) - [49/66] "Angela Melillo-Pomeriggio Cinque 30-11-16 (29min 59secs) (H264 1080i AC3 dvbt).ts.jpg" yEnc (1/2)CPP-User03-Dec
Z.Nation.S03E12.720p.WEB-DL.x264-FUM [1/22] "Z.Nation.S03E12.720p.WEB-DL.x264-FUM.par2" yEnc (1/1)
collection size: 1.44 GB, parts available: 1960 / 1960
- 14 rar files
- 8 par2 files
bob@bobbers.bob03-Dec
Z.Nation.S03E12.720p.HDTV.2CH.x265.HEVC-PSA [1/24] "Z.Nation.S03E12.720p.HDTV.2CH.x265.HEVC-PSA.par2" yEnc (1/1)
collection size: 273.36 MB, parts available: 369 / 369
- 17 rar files
- 7 par2 files
bob@bobbers.bob03-Dec
The.Strain.3x03.Il.Primogenito.ITA.DLMux.x264-NovaRip [1/1] - "The.Strain.3x03.Il.Primogenito.ITA.DLMux.x264-NovaRip.nzb" yEnc (1/1)ita.tv 03-Dec
The.Strain.3x03.Il.Primogenito.ITA.720p.DLMux.DD5.1.x264-NovaRip [1/1] - "The.Strain.3x03.Il.Primogenito.ITA.720p.DLMux.DD5.1.x264-NovaRip.nzb" yEnc (1/1)ita.tv 03-Dec
Greys.Anatomy.13x03.Non.Faccio.Miracoli.ITA.DLMux.x264-NovaRip [1/1] - "Greys.Anatomy.13x03.Non.Faccio.Miracoli.ITA.DLMux.x264-NovaRip.nzb" yEnc (1/1)ita.tv 03-Dec
Dyauqinqaih-10635825684-201612021745 [10/163] - "Dyauqinqaih-10635825684-201612021745.part009.rar" yEnc (1/140) 100000000
collection size: 11.88 GB, parts available: 17292 / 22613
- 107 rar files
- 55 par2 files
- 1 nzb file
- 1 sfv file
radombk02-Dec
Angela Melillo-Pomeriggio Cinque 30-11-16 (29min 59secs) - [00/66] "Angela Melillo-Pomeriggio Cinque 30-11-16 (29min 59secs) (H264 1080i AC3 dvbt).nzb" yEnc (1/2)
collection size: 1.19 GB, parts available: 3231 / 3231
- 18 par2 files
- 47 rar files
- 1 nzb file
CPP-User03-Dec
The.Strain.3x03.Il.Primogenito.ITA.DLMux.x264-NovaRip [01/16] - "the.strain.3x03.ita.dlmux.x264-novarip.nfo" yEnc (1/1)
collection size: 324.01 MB, parts available: 438 / 438
- 9 par2 files
- 6 rar files
- 1 nfo file
view NFO
ita.tv 03-Dec
The.Strain.3x03.Il.Primogenito.ITA.720p.DLMux.DD5.1.x264-NovaRip [03/23] - "the.strain.3x03.ita.720p.dlmux.dd5.1.x264-novarip.part01.rar" yEnc (1/69)
collection size: 699.52 MB, parts available: 940 / 940
- 9 par2 files
- 13 rar files
- 1 nfo file
view NFO
ita.tv 03-Dec
QueeG5Yae5ohCooghai1Aothee8Ohchu [82/90] - "ainie1eishu5Eitheey8soipaesaesh1.jpg" yEnc (1/1) 77632veocuS03-Dec
Iuuaahuyrn-8336643072-201612021615 [4/128] - "Iuuaahuyrn-8336643072-201612021615.part03.rar" yEnc (1/140) 100000000
collection size: 12.17 GB, parts available: 17718 / 17718
- 84 rar files
- 43 par2 files
- 1 sfv file
- 1 nzb file
radombk02-Dec
Greys.Anatomy.13x03.Non.Faccio.Miracoli.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip [1/1] - "Greys.Anatomy.13x03.Non.Faccio.Miracoli.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip.nzb" yEnc (1/1)ita.tv 03-Dec
Dqdura-151376-201612021556 "Dqdura-151376-201612021556.nzb" yEnc (1/1) 1693
collection size: 313.74 KB, parts available: 5 / 5
- 2 par2 files
- 1 rar file
- 1 sfv file
- 1 nzb file
radombk02-Dec
Uodduhiaoy-3911348690-201612020420 "Uodduhiaoy-3911348690-201612020420.nzb" yEnc (1/2) 821819
collection size: 5.73 GB, parts available: 8352 / 8352
- 41 par2 files
- 79 rar files
- 1 sfv file
- 1 nzb file
radombk01-Dec
The.Americans.4x01.Armi.Biologiche.ITA.DLMux.x264-NovaRip [1/1] - "The.Americans.4x01.Armi.Biologiche.ITA.DLMux.x264-NovaRip.nzb" yEnc (1/1)ita.tv 03-Dec
QueeG5Yae5ohCooghai1Aothee8Ohchu [83/90] - "ainie1eishu5Eitheey8soipaesaesh1.par2" yEnc (1/1) 476
collection size: 1.86 MB, parts available: 3 / 3
- 2 par2 files
veocuS03-Dec
Greys.Anatomy.13x03.Non.Faccio.Miracoli.ITA.DLMux.x264-NovaRip [01/18] - "greys.anatomy.13x03.ita.dlmux.x264-novarip.nfo" yEnc (1/1)
collection size: 411.13 MB, parts available: 557 / 557
- 9 par2 files
- 8 rar files
- 1 nfo file
view NFO
ita.tv 03-Dec
Dqhydnyiud-1540120831-201612020458 [10/49] - "Dqhydnyiud-1540120831-201612020458.part09.rar" yEnc (1/70) 50000000
collection size: 2.24 GB, parts available: 3263 / 3263
- 31 rar files
- 17 par2 files
- 1 sfv file
- 1 nzb file
radombk01-Dec
cahwah0niph3ah0eihieM7xeing1Iezo [55/56] - "vohthaeshoonai3Igh7ieTi9bei3iwie.vol2+2.par2" yEnc (1/3) 770036
collection size: 12.01 MB, parts available: 36 / 36
- 4 par2 files
- 1 mkv file
Cheiya03-Dec
cahwah0niph3ah0eihieM7xeing1Iezo [3/56] - "aep6oor1xes0Oow9Oa7jie4hoo4OimeG.vol0+1.par2" yEnc (1/2) 384548
collection size: 427.48 KB, parts available: 4 / 4
- 1 jpg file
- 2 par2 files
Cheiya03-Dec
cahwah0niph3ah0eihieM7xeing1Iezo [15/56] - "cahwah0niph3ah0eihieM7xeing1Iezo.r10" yEnc (1/40) 15000000
collection size: 631.49 MB, parts available: 1708 / 1708
- 39 rar files
- 9 par2 files
Cheiya03-Dec
The.Americans.4x01.Armi.Biologiche.ITA.DLMux.x264-NovaRip [02/18] - "the.americans.4x01.ita.dlmux.x264-novarip.par2" yEnc (1/1)
collection size: 410.64 MB, parts available: 556 / 556
- 8 rar files
- 9 par2 files
- 1 nfo file
view NFO
ita.tv 03-Dec
The.Americans.4x01.Armi.Biologiche.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip [1/1] - "The.Americans.4x01.Armi.Biologiche.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip.nzb" yEnc (1/1)ita.tv 03-Dec
QueeG5Yae5ohCooghai1Aothee8Ohchu [87/90] - "aph2chei2OH0oL2ohmieve6Eav8hued6.vol0+3.par2" yEnc (1/4) 5762744
collection size: 98.07 MB, parts available: 57 / 57
- 5 par2 files
- 1 mkv file
veocuS03-Dec
Greys.Anatomy.13x03.Non.Faccio.Miracoli.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip [01/50] - "greys.anatomy.13x03.ita-eng.1080p.dlmux.dd5.1.h264-novarip.nfo" yEnc (1/1)
collection size: 2.12 GB, parts available: 2901 / 2901
- 10 par2 files
- 39 rar files
- 1 nfo file
view NFO
ita.tv 03-Dec
(STEM0707)- [00/78] - "The.Voice.of.Holland.S07E07.HDTV.DD5.1.part.nzb" yEnc (1/15)
collection size: 7.56 GB, parts available: 31462 / 31462
- 75 rar files
- 1 par2 file
- 1 par file
- 1 sfv file
- 1 nzb file
Smokey7903-Dec
(1/9) - Allo Docteurs - Malformations cardiaques de l'enfant - quelle prise en charge - "Malformations cardiaques de l'enfant - quelle prise en charge.mkv.par2" - 282,93 MB - yEnc (1/1)
collection size: 26.97 MB, parts available: 78 / 78
- 8 par2 files
SSL-News.info 03-Dec
QueeG5Yae5ohCooghai1Aothee8Ohchu [12/90] - "QueeG5Yae5ohCooghai1Aothee8Ohchu.r10" yEnc (1/79) 150000000
collection size: 10.67 GB, parts available: 5849 / 5849
- 10 par2 files
- 71 rar files
veocuS03-Dec
(1/9) - Allo Docteurs - Malformations cardiaques de l'enfant - quelle prise en charge - "Malformations cardiaques de l'enfant - quelle prise en charge.mkv" - 282,93 MB - yEnc (1/702)SSL-News.info 03-Dec
The.Americans.4x01.Armi.Biologiche.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip [04/53] - "the.americans.4x01.ita-eng.1080p.dlmux.dd5.1.h264-novarip.part02.rar" yEnc (1/69)
collection size: 2.3 GB, parts available: 3150 / 3150
- 10 par2 files
- 42 rar files
- 1 nfo file
view NFO
ita.tv 03-Dec
tuGbA70RAeEpPF0c0yKmxw7OC - "65JPDzr0NCXm8wIl1zyzgrQv2.par2" - yEnc (1/1)
collection size: 1.3 GB, parts available: 3515 / 3515
- 9 par2 files
- 6 rar files
"FYuB30ENJt" 03-Dec
Niqqyyyhoo-2855000499-201612032031 [1/89] - "Niqqyyyhoo-2855000499-201612032031.par2" yEnc (1/1) 46304
collection size: 4.18 GB, parts available: 6081 / 6081
- 30 par2 files
- 1 nzb file
- 1 sfv file
- 58 rar files
radombk03-Dec
Legalize Suicide William.Shatner.Bohemian.Rhapsody.mp3 3 of 8 Pair of Favourites: Non-Singers Not singing Songs (1/44)Yenc-PP-A&A03-Dec
Legalize Suicide Peter.Sellers.A.hard.days.night.1966.mp3 2 of 8 Pair of Favourites: Non-Singers Not singing Songs (1/18)Yenc-PP-A&A03-Dec
Legalize Suicide Pair.of.Favourites.Non-Singers.Not.singing.Songs.nzb 0 of 8 Pair of Favourites: Non-Singers Not singing Songs (1/1)Yenc-PP-A&A03-Dec
Legalize Suicide Pair.of.Favourites.Non-Singers.Not.singing.Songs.mp3.par2 1 of 8 Pair of Favourites: Non-Singers Not singing Songs (1/1)
collection size: 10.64 MB, parts available: 48 / 48
- 6 other files
Yenc-PP-A&A03-Dec
2k60GIX2ims7I2dqpDLAUM44j - "Pn2X42aN3HO4oW05ViOWz20QR.par2" - yEnc (1/1)
collection size: 130.61 MB, parts available: 348 / 348
- 9 par2 files
- 1 rar file
"zeuI7QnN2w" 03-Dec
"Usenet Index Post 1480756059 yEnc (1/01)"NzbIndexer@alt.binaries.multimedia03-Dec
Westworld.1x08.Segni.Di.Cedimento.ITA.DLMux.x264-NovaRip [1/1] - "Westworld.1x08.Segni.Di.Cedimento.ITA.DLMux.x264-NovaRip.nzb" yEnc (1/1)ita.tv 03-Dec
WSF2mJfEIYO6ZkGN4k6M5L488 - "83LNHVx98336wpAkOGBxe6jxp.par2" - yEnc (1/1)
collection size: 555.68 MB, parts available: 1468 / 1468
- 9 par2 files
- 3 rar files
"6d69SOph5g" 03-Dec
(1/13) "PW-UK0212.par2" - 328,19 MB - [powered by gehtdinixo] yEnc (1/1)
collection size: 340.63 MB, parts available: 903 / 903
- 6 par2 files
- 7 rar files
JBinUp.com 03-Dec
(1/13) "PW-RMSC0212.par2" - 308,39 MB - [powered by gehtdinixo] yEnc (1/1)
collection size: 320.09 MB, parts available: 849 / 849
- 6 par2 files
- 7 rar files
JBinUp.com 03-Dec
Westworld.1x08.Segni.Di.Cedimento.ITA.DLMux.x264-NovaRip [18/19] - "westworld.1x08.ita.dlmux.x264-novarip.vol063+64.par2" yEnc (1/20)
collection size: 493.66 MB, parts available: 666 / 666
- 9 par2 files
- 9 rar files
- 1 nfo file
view NFO
ita.tv 03-Dec
Westworld.1x08.Segni.Di.Cedimento.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip [1/1] - "Westworld.1x08.Segni.Di.Cedimento.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip.nzb" yEnc (1/1)ita.tv 03-Dec
Westworld.1x08.Segni.Di.Cedimento.ITA-ENG.1080p.DLMux.DD5.1.h264-NovaRip [01/48] - "westworld.1x08.ita-eng.1080p.dlmux.dd5.1.h264-novarip.nfo" yEnc (1/1)
collection size: 2.05 GB, parts available: 2805 / 2805
- 10 par2 files
- 37 rar files
- 1 nfo file
view NFO
ita.tv 03-Dec
Uhyohyond-340940921-201612031949 "Uhyohyond-340940921-201612031949.nzb" yEnc (1/1) 79742
collection size: 509.16 MB, parts available: 730 / 730
- 23 rar files
- 13 par2 files
- 1 sfv file
- 1 nzb file
radombk03-Dec
Drauqqohdi-1763559418-201612031959 [1/56] - "Drauqqohdi-1763559418-201612031959.par2" yEnc (1/1) 65396
collection size: 2.56 GB, parts available: 3739 / 3739
- 19 par2 files
- 36 rar files
- 1 nzb file
- 1 sfv file
radombk03-Dec
"zgtrtrfiy dxghtwfgjq0000307" [000/471] - "dxghtwfgjq0000307.nzb" yEnc (1/43)
collection size: 11.6 GB, parts available: 48347 / 48687
- 244 other files
Yenc-PP-A&A03-Dec
Il Grande Fratello VIP DayTime Notte 18-10-16 (5h 21min 56secs) - [00/94] "Il Grande Fratello VIP DayTime Notte 18-10-16 (5h 21min 56secs) (MPEG2 dvbt).nzb" yEnc (1/7)
collection size: 6.98 GB, parts available: 18921 / 18921
- 24 par2 files
- 69 rar files
- 1 jpg file
- 1 nzb file
CPP-User03-Dec
"zgtrtrfiy dxghtwfgjq0000300" [000/458] - "dxghtwfgjq0000300.nzb" yEnc (1/41)
collection size: 14.1 GB, parts available: 58765 / 59137
- 296 other files
Yenc-PP-A&A03-Dec
Nidahiqyod-2816485091-201612031807 [1/88] - "Nidahiqyod-2816485091-201612031807.par2" yEnc (1/1) 45620
collection size: 4.12 GB, parts available: 5995 / 5995
- 30 par2 files
- 1 nzb file
- 1 sfv file
- 57 rar files
radombk03-Dec
"Usenet Index Post 1480738137 yEnc (1/01)"NzbIndexer@alt.binaries.multimedia03-Dec
Duaqhdyiir-1365410887-201612031750 [1/44] - "Duaqhdyiir-1365410887-201612031750.par2" yEnc (1/1) 50704
collection size: 1.98 GB, parts available: 2896 / 2896
- 28 rar files
- 15 par2 files
- 1 nzb file
- 1 sfv file
radombk03-Dec
Hyynquqord-4002535971-201612031702 [1/124] - "Hyynquqord-4002535971-201612031702.par2" yEnc (1/1) 64776
collection size: 5.86 GB, parts available: 8549 / 8549
- 42 par2 files
- 81 rar files
- 1 nzb file
- 1 sfv file
radombk03-Dec
Il Grande Fratello VIP DayTime Sera 14-10-16 (4h 19min 16secs) - [00/98] "Il Grande Fratello VIP DayTime Sera 14-10-16 (4h 19min 16secs) (MPEG2 dvbt).nzb" yEnc (1/7)
collection size: 7.36 GB, parts available: 19954 / 19954
- 24 par2 files
- 73 rar files
- 1 jpg file
- 1 nzb file
CPP-User03-Dec
Fixer.Upper.S04E01.A.Dog-Loving.Couple.Searches.for.Their.First.Home.720p.WEB-DL.AAC2.0.H.264-koalf [1/21] "Fixer.Upper.S04E01.A.Dog-Loving.Couple.Searches.for.Their.First.Home.720p.WEB-DL.AAC2.0.H.264-koalf.par2" yEnc (1/1)
collection size: 1.36 GB, parts available: 1849 / 1849
- 13 rar files
- 8 par2 files
bob@bobbers.bob03-Dec
Dnuuyuudiu-1233033183-201612031645 "Dnuuyuudiu-1233033183-201612031645.nzb" yEnc (1/1) 257798
collection size: 1.79 GB, parts available: 2613 / 2613
- 25 rar files
- 14 par2 files
- 1 sfv file
- 1 nzb file
radombk03-Dec
Dhyynhuuqh-1400243354-201612031621 [1/45] - "Dhyynhuuqh-1400243354-201612031621.par2" yEnc (1/1) 52068
collection size: 2.03 GB, parts available: 2972 / 2972
- 15 par2 files
- 1 sfv file
- 29 rar files
- 1 nzb file
radombk03-Dec
Uhuonrrih-343927784-201612031616 [1/37] - "Uhuonrrih-343927784-201612031616.par2" yEnc (1/1) 17132
collection size: 513.35 MB, parts available: 736 / 736
- 23 rar files
- 13 par2 files
- 1 sfv file
- 1 nzb file
radombk03-Dec
Qyiaqiqqr-508658557-201612031601 "Qyiaqiqqr-508658557-201612031601.nzb" yEnc (1/1) 118259
collection size: 760.03 MB, parts available: 1089 / 1089
- 34 rar files
- 18 par2 files
- 1 sfv file
- 1 nzb file
radombk03-Dec
"zgtrtrfiy dxghtwfgjq0000304" [000/464] - "dxghtwfgjq0000304.nzb" yEnc (1/42)
collection size: 18.59 GB, parts available: 77468 / 77831
- 389 other files
Yenc-PP-A&A03-Dec
Zelig Event Michelle Hunziker 01-12-16 (2h 7min 29secs) - [118/119] "spot Zelig Michelle Hunziker Dal 1 Dicembre (30secs) (H264 1080i AC3 dvbt).ts" yEnc (1/80)
collection size: 30.55 MB, parts available: 82 / 82
- 1 jpg file
- 1 ts file
CPP-User03-Dec
Zelig Event Michelle Hunziker 01-12-16 (2h 7min 29secs) - [116/119] "spot Zelig Michelle Hunziker Dal 1 Dicembre (19secs) (H264 1080i AC3 dvbt).ts" yEnc (1/56)
collection size: 21.63 MB, parts available: 58 / 58
- 1 jpg file
- 1 ts file
CPP-User03-Dec
Zelig Event Michelle Hunziker 01-12-16 (2h 7min 29secs) - [115/119] "spot Zelig Michelle Hunziker Dal 1 Dicembre #2 (19secs) (H264 1080i AC3 dvbt).ts.jpg" yEnc (1/2)CPP-User03-Dec
Zelig Event Michelle Hunziker 01-12-16 (2h 7min 29secs) - [114/119] "spot Zelig Michelle Hunziker Dal 1 Dicembre #2 (19secs) (H264 1080i AC3 dvbt).ts" yEnc (1/49)CPP-User03-Dec
Zelig Event Michelle Hunziker 01-12-16 (2h 7min 29secs) - [112/119] "spot Zelig Michelle Hunziker Da Giovedì 30-11-16 (60secs) (H264 1080i AC3 dvbt).ts" yEnc (1/157)
collection size: 59.68 MB, parts available: 159 / 159
- 1 jpg file
- 1 ts file
CPP-User03-Dec
Il Grande Fratello VIP DayTime Sera 15-10-16 (4h 18min 56secs) - [00/97] "Il Grande Fratello VIP DayTime Sera 15-10-16 (4h 18min 56secs) (MPEG2 dvbt).nzb" yEnc (1/7)
collection size: 7.3 GB, parts available: 19789 / 19790
- 72 rar files
- 24 par2 files
- 1 jpg file
- 1 nzb file
CPP-User03-Dec
Zelig Event Michelle Hunziker 01-12-16 (2h 7min 29secs) - [085/119] "Zelig Event Michelle Hunziker 01-12-16 (2h 7min 29secs) (H264 1080i AC3 dvbt).ts.jpg" yEnc (1/2)CPP-User03-Dec
View other 3 posts by CPP-user@domain.com (CPP-User) [Multiple posts by same poster hidden]
Duaraoruuy-1367697330-201612031350 "Duaraoruuy-1367697330-201612031350.nzb" yEnc (1/1) 285999
collection size: 1.99 GB, parts available: 2900 / 2900
- 28 rar files
- 15 par2 files
- 1 sfv file
- 1 nzb file
radombk03-Dec
Dyhoaqhaqi-1049654658-201612031323 "Dyhoaqhaqi-1049654658-201612031323.nzb" yEnc (1/1) 243295
collection size: 1.54 GB, parts available: 2242 / 2242
- 36 par2 files
- 70 rar files
- 1 sfv file
- 1 nzb file
radombk03-Dec
[1/5] - "LAT_lok8zpGaoMM334rR.par2" - 15,38 MB yEnc (1/1)
collection size: 15.97 MB, parts available: 46 / 46
- 2 par2 files
- 2 rar files
- 1 nfo file
view NFO
"<<< XRCfSof2Nn11e7 >>>" 03-Dec
Zelig Event Michelle Hunziker 01-12-16 (2h 7min 29secs) - [001/119] "Zelig Event Michelle Hunziker 01-12-16 (2h 7min 29secs) (H264 1080i AC3 dvbt).par2" yEnc (1/1)
collection size: 10.47 GB, parts available: 28388 / 28388
- 27 par2 files
- 83 rar files
CPP-User03-Dec
Zelig Event Michelle Hunziker 01-12-16 (2h 7min 29secs) - [000/119] "Zelig Event Michelle Hunziker 01-12-16 (2h 7min 29secs).nzb" yEnc (1/10)CPP-User03-Dec
Nrodyuuya-279103306-201612031214 "Nrodyuuya-279103306-201612031214.nzb" yEnc (1/1) 65449
collection size: 416.34 MB, parts available: 597 / 597
- 11 par2 files
- 19 rar files
- 1 sfv file
- 1 nzb file
radombk03-Dec
"{6419C000-1D48-41F5-8309-FCB71B207167}" yEnc (1/274)SSL-News.info 03-Dec
"{6397F560-3515-4672-91FC-65B78D39D886}" yEnc (1/274)SSL-News.info 03-Dec
"{6384F496-D4D6-4986-85BF-F8885AAC9648}" yEnc (1/274)SSL-News.info 03-Dec
"{61EDEB09-43D5-439D-964D-00CA633E414F}" yEnc (1/274)SSL-News.info 03-Dec
"{6140A22F-451B-47DE-B40D-37902F01DB57}" yEnc (1/274)SSL-News.info 03-Dec
"{604FC7E4-10F6-4670-A9D0-AC913E8F5511}" yEnc (1/274)SSL-News.info 03-Dec
"{5B02F398-34DA-43BA-A75F-8B34CBB4A9D4}" yEnc (1/274)SSL-News.info 03-Dec
"{5A40AE30-0CE1-4B41-A810-98443B8264AA}" yEnc (1/274)SSL-News.info 03-Dec
"{5923B875-F8D7-4F3B-8024-38BECEAC0228}" yEnc (1/274)SSL-News.info 03-Dec
"{58D4342D-C916-4758-81BA-39A1FC60A627}" yEnc (1/274)SSL-News.info 03-Dec
"{56818783-A200-41EA-ACC9-96F90BE378DC}" yEnc (1/274)SSL-News.info 03-Dec
"{565B6611-93D8-46E6-A9BC-DDC452312F33}" yEnc (1/274)SSL-News.info 03-Dec
"{54F889F5-5683-42D9-9F9E-7A6DB30A7213}" yEnc (1/274)SSL-News.info 03-Dec
"{53B76861-6BFE-45BB-A94E-FF6BB66FA72A}" yEnc (1/274)SSL-News.info 03-Dec
"{534717BA-D3D3-4BBC-A6AD-7ED0F4913D48}" yEnc (1/274)SSL-News.info 03-Dec
"{4EEE8CB9-6D1A-43CE-9BC9-6585921AAAF9}" yEnc (1/274)SSL-News.info 03-Dec
"{48C48B0C-BD95-47FC-B4E2-A3948231C434}" yEnc (1/274)SSL-News.info 03-Dec
"{47D8ACAC-0DB3-41F9-9AA5-88EBD7979FD7}" yEnc (1/274)SSL-News.info 03-Dec
"{45A7D6B6-00D3-4189-90FD-E07CBCE18455}" yEnc (1/274)SSL-News.info 03-Dec
"{3BBEFC42-BA1F-408D-9EA1-E0259E3A187B}" yEnc (1/274)SSL-News.info 03-Dec
"{2B73EAE0-1A9A-4BFC-8CD4-D8368D53CB5F}" yEnc (1/274)SSL-News.info 03-Dec
"{63327FC1-018F-40A1-8BD4-0AECEE24CCC0}" yEnc (1/274)SSL-News.info 03-Dec
"{5F015D0D-3807-4EFB-9CFB-215F056E9992}" yEnc (1/274)SSL-News.info 03-Dec
"{5EA07B0A-983A-44F5-8B76-44383F62A1E5}" yEnc (1/274)SSL-News.info 03-Dec
"{5A14E253-EBF3-4ECA-88F0-FEF80AC31CD9}" yEnc (1/274)SSL-News.info 03-Dec
"{59BE73DE-A6B0-4832-A1A8-EFF26DE19CA9}" yEnc (1/274)SSL-News.info 03-Dec
"{584B0291-AEA9-4F44-9BC4-F79E5E325BEA}" yEnc (1/274)SSL-News.info 03-Dec
"{5815008D-F408-41F4-88EA-9FFCFF030693}" yEnc (1/274)SSL-News.info 03-Dec
"{55B45FD9-2A8C-4A86-B777-2734C785E840}" yEnc (1/274)SSL-News.info 03-Dec
"{53E48EFE-F96B-4490-AE2C-E073BE4D8A63}" yEnc (1/274)SSL-News.info 03-Dec
"{5328BB4A-A010-4491-8F58-8894AEF512AA}" yEnc (1/274)SSL-News.info 03-Dec
"{52A8B9C8-CFF2-4BD1-B88E-84FFF36C26C6}" yEnc (1/274)SSL-News.info 03-Dec
"{5157DAA7-C08B-4D2B-B7BE-2E35B5A4FA78}" yEnc (1/274)SSL-News.info 03-Dec
"{50D2F9F6-F62B-48A6-805B-3C0337530E28}" yEnc (1/274)SSL-News.info 03-Dec
"{4E50BC9C-384F-4719-B1F3-092D4318EA1E}" yEnc (1/274)SSL-News.info 03-Dec
"{4DA6DC39-15D1-4BE3-9319-307C7C1C9A56}" yEnc (1/274)SSL-News.info 03-Dec
"{4D9176B5-FB84-40B6-9D1A-EB54F52E862E}" yEnc (1/274)SSL-News.info 03-Dec
"{4C97A7F9-F186-45CB-A4F6-D5E575647D27}" yEnc (1/274)SSL-News.info 03-Dec
"{4B858EFF-E1F7-46DF-9A95-63AA91F176E9}" yEnc (1/274)SSL-News.info 03-Dec
"{4A3C7E18-1654-4D8B-9CB1-DFED165C2E29}" yEnc (1/274)SSL-News.info 03-Dec
"{4A15E536-0E3E-45B1-B57F-D32A6561CE1B}" yEnc (1/274)SSL-News.info 03-Dec
"{49EFFC52-27C4-42AD-8E8C-9DFF11737A3C}" yEnc (1/274)SSL-News.info 03-Dec
"{48B06E2E-0967-465E-A28E-E33EC8A91552}" yEnc (1/274)SSL-News.info 03-Dec
"{47D3331E-B935-4349-BC11-932C325887CB}" yEnc (1/274)SSL-News.info 03-Dec
"{47873026-E15A-454D-B3A7-9B0F5B393B65}" yEnc (1/274)SSL-News.info 03-Dec
"{47700E3F-B4C3-4AA2-8064-525A51C9D976}" yEnc (1/274)SSL-News.info 03-Dec
"{470EBE0C-BAE5-4C25-81B4-EF3CC7E0104D}" yEnc (1/274)SSL-News.info 03-Dec
"{467CF3F0-E68F-4BC0-8C0A-12F31C00FC62}" yEnc (1/274)SSL-News.info 03-Dec
"{4618E0E4-68D4-4675-84BE-A6210E7FAA83}" yEnc (1/274)SSL-News.info 03-Dec
"{45F27F6C-3166-47E0-B5B3-EAC2D991B1B8}" yEnc (1/274)SSL-News.info 03-Dec
"{44D72D11-437F-4742-B657-90ECC11233CB}" yEnc (1/274)SSL-News.info 03-Dec
"{44CA0603-865F-43AE-9872-97857A68AE44}" yEnc (1/274)SSL-News.info 03-Dec
"{4364766D-14FB-4295-847B-AE33BEC3614D}" yEnc (1/274)SSL-News.info 03-Dec
"{43085906-DDBC-4A7E-8855-09CBD79CC060}" yEnc (1/274)SSL-News.info 03-Dec
"{3EF2F330-05F8-49FE-B0E6-95F5BBF76760}" yEnc (1/274)SSL-News.info 03-Dec
"{3C165B39-2A7F-4004-90D5-7CC3376634F3}" yEnc (1/274)SSL-News.info 03-Dec
"{3B4282F4-51B4-49D8-83C6-189812EFBC33}" yEnc (1/274)SSL-News.info 03-Dec
"{3AD24FBB-1216-40E5-A894-1053FBF610A0}" yEnc (1/274)SSL-News.info 03-Dec
"{39D4CA6C-33B4-4C20-8185-B84E00FCAD21}" yEnc (1/274)SSL-News.info 03-Dec
"{39B5B0ED-56E6-4160-8052-2379A4523D1F}" yEnc (1/274)SSL-News.info 03-Dec
"{395B9FB6-1F33-44C4-8475-D8EADC28AAE3}" yEnc (1/274)SSL-News.info 03-Dec
"{38758866-0EBB-4513-9BB0-A7468DFB3D5D}" yEnc (1/274)SSL-News.info 03-Dec
"{378311E9-4608-4E35-80A1-E198C5D56744}" yEnc (1/274)SSL-News.info 03-Dec
"{3748CB91-470B-4C84-935C-12C12E45EEDE}" yEnc (1/274)SSL-News.info 03-Dec
"{35FAD52D-CA20-4FEA-95C9-28B8D3408C76}" yEnc (1/274)SSL-News.info 03-Dec
"{341AB924-267B-4E3F-91E7-6AF3C6B16846}" yEnc (1/274)SSL-News.info 03-Dec
"{30A618E7-9349-41A7-B6E0-5A050954144D}" yEnc (1/274)SSL-News.info 03-Dec
"{3079A64A-A89F-432B-89E7-A1C1D6D213DA}" yEnc (1/274)SSL-News.info 03-Dec
"{2ECCBACC-91DB-469E-8DF5-5EE407D22F11}" yEnc (1/274)SSL-News.info 03-Dec
"{2D248ECE-FE99-4CB4-8F3B-BF9EF76A9F06}" yEnc (1/274)SSL-News.info 03-Dec
"{2C148846-2612-4B91-A6E7-29373EDA8A35}" yEnc (1/274)SSL-News.info 03-Dec
"{2B6C7AC4-2082-40A4-A51B-2FD197702A57}" yEnc (1/274)SSL-News.info 03-Dec
"{26F8AA1B-9F58-45F2-A2EB-41C4A6A41855}" yEnc (1/274)SSL-News.info 03-Dec
"{2361DF83-1F8F-4740-8402-4D27F049F196}" yEnc (1/274)SSL-News.info 03-Dec
"{22F5303D-7052-4ABB-87E9-32ED8BC79C6B}" yEnc (1/274)SSL-News.info 03-Dec
"{22CC1752-D865-498A-B473-0D05A0514DA9}" yEnc (1/274)SSL-News.info 03-Dec
"{20809897-3ED7-4769-81F5-5382E26E5426}" yEnc (1/274)SSL-News.info 03-Dec
"{1FFA6D99-53BD-46D1-99FD-2560BECFB8C2}" yEnc (1/274)SSL-News.info 03-Dec
"{1F5663E8-5DB1-4982-A28B-4C3FF9C3D083}" yEnc (1/274)SSL-News.info 03-Dec
"{1E39E3BA-ED4B-4847-81AD-16E9D20BF60D}" yEnc (1/274)SSL-News.info 03-Dec
"{1D6B4E3C-4F5A-470C-A85E-D31CB5E2D2C0}" yEnc (1/274)SSL-News.info 03-Dec
"{1CB66AC4-1A50-44DE-BDC0-75024EF21B08}" yEnc (1/274)SSL-News.info 03-Dec
"{17CE5240-441F-4F30-8F83-A31C0D3DFC0A}" yEnc (1/274)SSL-News.info 03-Dec
"{16E8E75F-4FF7-42FF-967B-D4A12CAAE2A8}" yEnc (1/274)SSL-News.info 03-Dec
"{10B349A5-7348-4F1D-A717-CE53883C5068}" yEnc (1/274)SSL-News.info 03-Dec
"{0CC5B286-9DC7-45E0-A94A-9A944257351D}" yEnc (1/274)SSL-News.info 03-Dec
"{08B40723-B749-404D-A6C1-002450E9C9C4}" yEnc (1/274)SSL-News.info 03-Dec
"{074E08CD-DFDF-4000-A0D4-31B65A208A66}" yEnc (1/274)SSL-News.info 03-Dec
"{013ECAE7-AABC-41B1-A01E-642F45398779}" yEnc (1/274)SSL-News.info 03-Dec
"{00094F89-6231-4DD9-8C2D-90232A924084}" yEnc (1/274)SSL-News.info 03-Dec
View other 86 posts by SSL-News.info <ssl-news.info@ssl.local> [Multiple posts by same poster hidden]
28ec2c38-5499-5f74-9588-8d2a3849fc74 [001/242] - "28ec2c38-5499-5f74-9588-8d2a3849fc74.par2" yEnc (1/1)
collection size: 23.88 GB, parts available: 24267 / 24267
- 26 par2 files
- 216 rar files
genex@genex.com03-Dec
"{35B95FFC-A013-475C-82B8-70D71AF28967}" yEnc (1/274)SSL-News.info 03-Dec
"{2F49EEBA-002E-43CA-A31E-95BAE5D3CA49}" yEnc (1/274)SSL-News.info 03-Dec
"{2BDAE72D-8462-457B-965E-7A384D1159E4}" yEnc (1/274)SSL-News.info 03-Dec
"{25D01B6B-5EC9-44B2-8A15-153393559452}" yEnc (1/274)SSL-News.info 03-Dec
"{22488F22-CD71-47E3-867D-AA4EDD6D2BFF}" yEnc (1/274)SSL-News.info 03-Dec
"{1E4AEF14-3674-4404-ADE2-3BA9C1028AC5}" yEnc (1/274)SSL-News.info 03-Dec
"{1C826F07-0793-4612-8787-F554094CD06B}" yEnc (1/274)SSL-News.info 03-Dec
"{1AB703A0-631F-4936-920F-60570060B023}" yEnc (1/274)SSL-News.info 03-Dec
"{1553B548-8F92-4711-9A1C-1C05229828EA}" yEnc (1/274)SSL-News.info 03-Dec
"{13C34BA8-675A-4361-8573-035AA446DF06}" yEnc (1/274)SSL-News.info 03-Dec
"{13863DDC-4995-4437-B0AA-19D0E3B52869}" yEnc (1/274)SSL-News.info 03-Dec
"{0FD4E5A9-B4EC-4793-A909-DB771AB1D675}" yEnc (1/274)SSL-News.info 03-Dec
"{0F2BA08B-A083-4292-A599-3ECB4BBB45A3}" yEnc (1/274)SSL-News.info 03-Dec
"{0E78B555-86EB-4EBB-B620-C69DB95683D4}" yEnc (1/274)SSL-News.info 03-Dec
"{0CC100BD-F388-4BF3-A0CF-47B5BC1CB2A3}" yEnc (1/274)SSL-News.info 03-Dec
"{0C182986-2801-431C-82BF-74591E81A284}" yEnc (1/274)SSL-News.info 03-Dec
"{0B8BA557-65EF-4694-8D09-A56882D76F08}" yEnc (1/274)SSL-News.info 03-Dec
"{0B4FB981-0A37-4F72-951B-189EEF7553D5}" yEnc (1/274)SSL-News.info 03-Dec
"{0984B0DB-6829-4798-AD4B-02B342A923C6}" yEnc (1/274)SSL-News.info 03-Dec
"{096D35AB-341F-497D-B951-093C0D31569F}" yEnc (1/274)SSL-News.info 03-Dec
"{07CB816C-4674-413A-B8D0-7311766F9330}" yEnc (1/274)SSL-News.info 03-Dec
"{0301025D-B7CB-479E-94A6-AE641425CA90}" yEnc (1/274)SSL-News.info 03-Dec
"{02DF9561-AB2F-4F53-92A6-25F8C2BD2856}" yEnc (1/274)SSL-News.info 03-Dec
"{01BBE09D-1B35-4899-990B-736076F38726}" yEnc (1/274)SSL-News.info 03-Dec
"{019EED70-4CFE-4510-8502-B49988485212}" yEnc (1/274)SSL-News.info 03-Dec
View other 21 posts by SSL-News.info <ssl-news.info@ssl.local> [Multiple posts by same poster hidden]
"zgtrtrfiy dxghtwfgjq0000302" [000/472] - "dxghtwfgjq0000302.nzb" yEnc (1/43)
collection size: 22.55 GB, parts available: 93954 / 93954
- 473 other files
Yenc-PP-A&A03-Dec
"Usenet Index Post 1480719643 yEnc (1/01)"NzbIndexer@alt.binaries.multimedia03-Dec
"Usenet Index Post 1480719162 yEnc (1/01)"NzbIndexer@alt.binaries.multimedia03-Dec
"Usenet Index Post 1480717469 yEnc (1/01)"NzbIndexer@alt.binaries.multimedia03-Dec
"Usenet Index Post 1480717126 yEnc (1/01)"NzbIndexer@alt.binaries.multimedia03-Dec
Magnum Opus [01/43] "f9f16413-0ad8-5f2e-8285-6244123a4451.par2" yEnc (1/1)
collection size: 5.75 GB, parts available: 5820 / 5820
- 8 par2 files
- 35 rar files
Magnum Opus 02-Dec
Magnum Opus [01/42] "e9283b75-06c2-54be-be0c-9d6811328569.par2" yEnc (1/1)
collection size: 5.68 GB, parts available: 5754 / 5754
- 8 par2 files
- 34 rar files
Magnum Opus 02-Dec
(1/1) - COWGMMHcQ1brMaHtw6niE5FOdQvJzc - "COWGMMHcQ1brMaHtw6niE5FOdQvJzc.rar" - 9,41 MB yEnc (1/26)SSL-News.info 02-Dec
"{FE6D908C-D93D-41D6-925F-69FD36FDC3E2}" yEnc (1/274)SSL-News.info 02-Dec
"{FDA00EC5-4496-4CA9-91F5-1134DF1F7A80}" yEnc (1/274)SSL-News.info 02-Dec
"{FC66B074-2180-40CA-8F2E-D1BF6426ACC9}" yEnc (1/274)SSL-News.info 02-Dec
"{FB14BC93-97E4-4040-9C83-9BE3DD283BE3}" yEnc (1/274)SSL-News.info 02-Dec
"{FA095E9C-071D-4753-BE07-59813BC03A22}" yEnc (1/274)SSL-News.info 02-Dec
"{F947DBA5-4547-4DAD-8FC1-FB5635B2E7CE}" yEnc (1/274)SSL-News.info 02-Dec
"{F8ABCF0E-B0C1-4579-A095-A765C9B27353}" yEnc (1/274)SSL-News.info 02-Dec
"{F84B0D63-3217-4EE0-A116-64F060746545}" yEnc (1/274)SSL-News.info 02-Dec
"{F78D647E-9792-40D5-B80B-04EF8C28BD11}" yEnc (1/274)SSL-News.info 02-Dec
"{F6AA505D-AB71-46E1-8E91-11943B81EE51}" yEnc (1/274)SSL-News.info 02-Dec
"{F66A1586-91EA-44D9-B26A-C3AE50422C73}" yEnc (1/274)SSL-News.info 02-Dec
"{F49047B4-02D4-47F7-91A4-E8F014CA849B}" yEnc (1/274)SSL-News.info 02-Dec
"{EF3863AF-BCC6-4E3D-8281-2C4F085DBECA}" yEnc (1/274)SSL-News.info 02-Dec
"{EE15E642-4908-4A49-8AAE-5CDF6B055D61}" yEnc (1/274)SSL-News.info 02-Dec
"{EC603480-7467-43EA-9905-69AA38891E11}" yEnc (1/274)SSL-News.info 02-Dec
"{EC385586-CC73-4D05-8C54-912F93C63FB3}" yEnc (1/274)SSL-News.info 02-Dec
"{EAE7A91F-12FF-4CE6-80BA-965D9061B229}" yEnc (1/274)SSL-News.info 02-Dec
"{E88159E1-244B-4502-BAF2-518B83D89237}" yEnc (1/274)SSL-News.info 02-Dec
"{E75130EE-73A2-447C-B898-47594CEA6873}" yEnc (1/274)SSL-News.info 02-Dec
"{E5D8475C-E566-42C5-AE39-88366FD4704D}" yEnc (1/274)SSL-News.info 02-Dec
"{E58A8D3E-536C-4BB8-BA56-183D4CEC6BE5}" yEnc (1/274)SSL-News.info 02-Dec
"{E554315E-F694-47AF-A35F-D2B74D6EC56E}" yEnc (1/274)SSL-News.info 02-Dec
"{E233EB94-4902-4E81-AF0D-9B5B5B31D9C6}" yEnc (1/274)SSL-News.info 02-Dec
"{E21F706C-1525-424B-804F-59905A2FD617}" yEnc (1/274)SSL-News.info 02-Dec
"{E0838A63-212D-448A-A58F-2446E6D52DE8}" yEnc (1/274)SSL-News.info 02-Dec
"{E0264445-520C-481B-B6CC-19D7999B233D}" yEnc (1/274)SSL-News.info 02-Dec
"{DFF86A4B-CF8E-4836-8FF6-55D2B1D10FFF}" yEnc (1/274)SSL-News.info 02-Dec
"{DFB04F12-1C70-4126-BF4A-09E126C6CC50}" yEnc (1/274)SSL-News.info 02-Dec
"{DF85A85D-000D-47FC-9A53-EB555C47247C}" yEnc (1/274)SSL-News.info 02-Dec
View other 26 posts by SSL-News.info <ssl-news.info@ssl.local> [Multiple posts by same poster hidden]

<< < alt.binaries.multimedia >

 
 

Copyright © 2006-2011 binsearch - disclaimer